PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_33116
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family HB-other
Protein Properties Length: 230aa    MW: 25941.9 Da    PI: 7.919
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_33116genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.51.8e-111401857
                HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                lF +++yp++ ++ e ++k+gL+e+qV+ WF+ rR k+kk
  PEQU_33116  1 LFPEHKYPTEVMKLEFSEKIGLSEKQVSGWFCHRRLKDKK 40
                5899**********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF000464.9E-9140IPR001356Homeobox domain
PROSITE profilePS5007113.005141IPR001356Homeobox domain
SuperFamilySSF466893.68E-10247IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.7E-12240IPR009057Homeodomain-like
CDDcd000862.72E-8241No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
LFPEHKYPTE VMKLEFSEKI GLSEKQVSGW FCHRRLKDKK TLQGEICTNG KQNLSSSAVH  60
DRISGVKQES CSSTKQVDRN LDFKEVESKM YYGYRPCSDV LAYETSNKHP RTGIDHVAED  120
RSSGSSSASQ GSYLESHENP YVVQASGYKL CNDSGILMSN KNRVMKSNEN MGKPRHSFMR  180
VENDTPAISE LKWKLGSHYR EDGPLLGFEF DPIPPGAFDS PTRDSKFGNT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010926968.17e-70PREDICTED: uncharacterized protein LOC105049106 isoform X2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2549644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.19e-36HB-other family protein